Sign In | Join Free | My components-electronic.com
components-electronic.com
Products
Search by Category

noise reduction foam

All noise reduction foam wholesalers & noise reduction foam manufacturers come from members. We doesn't provide noise reduction foam products or service, please contact them directly and verify their companies info carefully.

Total 6852 products from noise reduction foam Manufactures & Suppliers
Buy cheap Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm product

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Chongqing Haike Thermal Insulation Material Co., Ltd.
Active Member

Chongqing

Buy cheap Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam product

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ...

SZ PUFENG PACKING MATERIAL LIMITED
Verified Supplier

Guangdong

Buy cheap 33kg/M3 2mm Laminate Underlay 200sqft/Roll Floor Impact Noise Reduction Underlayment product

Brand Name:new top star

Model Number:IXPE3030-4

Place of Origin:china

...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam...

Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier

Buy cheap 3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction product

Brand Name:CYG

Model Number:4012

Place of Origin:China

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ...

Cyg Tefa Co., Ltd.
Verified Supplier

Guangdong

Buy cheap Blue IXPE 2mm Foam Underlay Noise Reduction Underlay For Wood Floor product

Brand Name:No Brand

Model Number:30IXPE 20

Place of Origin:China

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As...

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Verified Supplier

Jiangsu

Buy cheap 38dB SNR 31dB NRR Noise Dampening Foam Ear Plugs 12*7*24mm product

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

...Foam Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear canal structures and have no pressure on ear High Noise Reduction: 38dB SNR (Single Number Rating) and 31dB NRR (Noise Reduction Rating) - They are two different rating systems; High noise reduction rate ear plugs can meet the needs of noise

JIAXING FUXING IMP. AND EXP. CO.,LTD
Active Member

Zhejiang

Buy cheap Noise Reduction IXPE Foam Underlay For Hard Wood Flooring product

Brand Name:HC

Model Number:IXPE3030-L

Place of Origin:CHINA

33kg/m3 IXPE Foam Underlay 200sqft/roll Noise Reduction Underlayment Black 3mm IXPE Normal Underlayment , Noise Reduction Underlayment Features Designed for noise reduction and cushioning under flooring Crush resistant, durable and high acoustic ...

CHANGZHOU HAICHEN PACKING MATERIAL CO.,LTD
Active Member

Jiangsu

Buy cheap Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones product

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Active Member

Guangdong

Buy cheap Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones product

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Verified Supplier

Guangdong

Buy cheap Knife Cutting Foam Crusher Machine Low Noise Pu Foam Shredder Machine product

Place of Origin:Qingdao, China

Brand Name:Xinmei

... noise knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with sponge regeneration equipment. Tdp-s-4 crusher is equipped with sound insulation and noise reduction device.

Qingdao Xinmeiteng Sponge Manufacture Co.
Verified Supplier

Shandong

Buy cheap Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs product

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

Buy cheap NOISE REDUCTION HEADPHONE #ANC-J3 product

Place of Origin:China

Model Number:#ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5

Shenzhen Bowei Electronics Co.,Ltd.
Active Member

Guangdong

Buy cheap Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip product

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Sichuan Jiayueda Building Materials Co., Ltd.
Site Member

Sichuan

Buy cheap FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design product

Brand Name:Future Tech

Model Number:FT-EM5002

Place of Origin:Shenzhen China

...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam...

FUTURE TECH LIMITED
Verified Supplier

Buy cheap Sound Barrier Noise Reduction Galvanized Highway Noise Barriers Wall product

Brand Name:YUDA

Model Number:Sound barrier

Place of Origin:CHINA

...barrier, or acoustical barrier) is an Sound insulation and noise reductionexterior structure designed to protect inhabitants of sensitive land use areas from noise pollution. Material: Metal type: galvanized sheet, aluminum sheet. Appearance: shutter type,

Anping Yuda Wire Mesh Co., Ltd.
Verified Supplier

Hebei

Buy cheap Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction product

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

Buy cheap Professional Noise Reduction Fence Soundproof Material Aluminum Sheet Metal product

Brand Name:TC

Model Number:TCNB

Place of Origin:China

... reduction of roads, highways, elevated composite roads and other noise sources. It is divided into a purely sound-reflecting reflective sound barrier, and a composite sound barrier combined with sound absorption and sound ...

Qingdao TaiCheng transportation facilities Co.,Ltd.
Verified Supplier

Shandong

Buy cheap Wireless Bass Bluetooth Headset Active Noise Reduction Headphones For Gaming Phone product

Brand Name:Aonike

Model Number:BT800

Place of Origin:China

... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chipset: TI (Texas Instruments) Noise reduction ...

Shengpai Electronics Co,ltd
Active Member

Guangdong

Buy cheap Split Audiophile Bluetooth Earbuds Noise Reduction Ipx5 Waterproof product

Brand Name:Artshow

Model Number:B09

Place of Origin:China

... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise.

Anhui Arts & Crafts Import & Export Company Ltd.
Verified Supplier

Anhui

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request