Sign In | Join Free | My components-electronic.com
components-electronic.com
Products
Search by Category
Home > Health & Medical > Respiratory Equipment >

Where To Inject Igf Lr3

where to inject igf lr3

All where to inject igf lr3 wholesalers & where to inject igf lr3 manufacturers come from members. We doesn't provide where to inject igf lr3 products or service, please contact them directly and verify their companies info carefully.

Total 1039 products from where to inject igf lr3 Manufactures & Suppliers
 Human Peptides IGF Lr3 For Greatly Boosts Muscle Mass 946870-92-4 Manufactures

Brand Name:Hongkong Blue Universal

Model Number:946870-92-4

Place of Origin:China

Human Peptides IGF Lr3 For Greatly Boosts Muscle Mass 946870-92-4 IGF --- Insulin-Like Growth Factors What is IGF1-LR3 ? IGF-1 is basically a polypeptide hormone that has the same ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

 Recombinant HGH Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Fat Loss Manufactures

Place of Origin:China(Mainland)

Brand Name:SUPER STEROIDS

Model Number:evelyn@chembj.com

Recombinant Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Losing Fat Quick Details: IGF LR3 -1 Assay:97% Model:10iu/vial Package:10vial/kit Apperance:White Lyophilized ...

Wuhan Hezhong Bio-Chemical Manufacture Co., Ltd.
Verified Supplier

Hubei

 Recombinant HGH Human Growth Hormone IGF LR3 -1 Muscle Growth Hormone Manufactures

Brand Name:jinshengyu

Model Number:001

Place of Origin:china

Detailed Product Description Recombinant Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Losing Fat Quick Details: IGF LR3 -1 Assay:97% Model:10iu/vial Package:10vial/kit ...

wuhan jin shengyu biological technology co.,ltd
Verified Supplier

Hubei

 Injectable Original Human Growth Insulin-Like Growth Factor 1 Peptides IGF Lr3 Manufactures

Brand Name:Gear-steroids

Model Number:IGF

Place of Origin:China

Injectable Original Human Growth Insulin-Like Growth Factor 1 Peptides IGF Lr3 Basic Info. Product name:Igf lr3 Apprience:Freeze-dried Powde Specification:1mg/vial;0.1mg/vial MOQ...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

 IGF-LR3 1mg/vial Anti-aging Fat Loss IGF LR3 Peptides HGH Growth Hormone Supplements Wrinkle Remover for Women Manufactures

Brand Name:YC

Model Number:CAS: 125-69-9

Place of Origin:China

IGF-LR3 Anti-aging Fat Loss IGF LR3 HGH Growth Hormone Supplements Wrinkle Remover for Women IGF-1Lr3 1mg/vial,10vials/kit 0.1mg/vial,10vials/kit 1. Payment & Shipping Terms: ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

 Recombinant Human Growth Hormone Injection IGF-1 LR3 Hormone Muscle Growth Manufactures

Brand Name:Igtropin Bio

Model Number:Igtropin igf-1 lr3

Place of Origin:China

Recombinant Human Growth Hormone Injection IGF-1 LR3 Hormone Description IGF-1 LR3, Long R3 IGF-1, IGF-1- Insulin-like Growth Factor – is an experimental drug that represents the ...

HongKong Amgen Biopharm CO.,LTD
Verified Supplier

Hong Kong

 Injectable Human Growth Hormone Peptide IGF LR3-1 1000mcg / Vial Long-R3 Igtropin Manufactures

Brand Name:Bodybiological

Place of Origin:Hubei, China

Injectable Human Growth Hormone Peptide IGF lR3-1 1000mcg/vial Long-R3 for Fatness Basic information: Product Name: IGTROPIN /IGF-1 lr3 Manufacturer: GenSci Laboratories, China. ...

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

 Recombinant Human LR3 IGF-I Protein for Bodybuilders and Athletes Manufactures

Brand Name:ChineseHormone

Model Number:CAS 946870-92-4

Place of Origin:China

Recombinant Human LR3 IGF-I Protein for Bodybuilders and Athletes CAS Number: 946870-92-4 Formula: C400H625N111O115S9 Molar mass: 9117.5 g/mol Biological half-life: 20–30 hours ...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

 GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial Manufactures

Brand Name:Biopro

Model Number:GHP-37

Place of Origin:China

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial Basic Info. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molar ...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

 White Powder IGF-1LR3 Peptide With Two Specifications For Muscle Building Manufactures

Brand Name:YC

Model Number:946870-92-4

Place of Origin:WUHAN CHINA

Product name:IGF-1Lr3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Description: IGF-1 is basically a polypeptide hormone that has the same some of the same molecular ...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

 Polypeptide Hormones IGF-1 Peptide Growth Hormone Supplements IGF-1 LR3 0.1mg Per ML Solution Manufactures

Brand Name:HKYCGC

Model Number:0.1mg Per ML;1mg Per ML

Place of Origin:China

Polypeptide Hormones IGF-1 Peptide Growth Hormone Supplements IGF-1 LR3 0.1mg Per ML Solution Product Description: IGF-LR3, it has anabolic effects, may increase muscular physique, ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

 Anti Ageing Supplements Weight Loss Hormones Human Growth Hormone Injections IGF-LR3 Manufactures

Place of Origin:China

Model Number:0.1mg/vial, 1mg/kits

Fat loss Human Growth Hormone Injections IGF-LR3 Anti Ggeing Supplements Enhanced Immunity Detailed Product Description Fat loss IGF-LR3, anti ageing supplements, enhanced immunity ...

Rebirth Biotech Co., Ltd.
Active Member

 Injectable Human Growth Hormone Peptide IGF LR3-1 1000mcg / Vial Long-R3 Igtropin Manufactures

Categories:Human Growth Hormone Peptide

Telephone:27-8753-6729

Country/Region:china

Detailed Product Description Keywords: IGF LR3-1 Alias: Igtropin Appearance: Freezed-dried Powder MOQ: 1kit Specification: 1000mcg/vial 10vials/kit Export Market: USA, UK, Thailand...

Wuhan Body Biological Co.,Ltd
ICP Remarked Supplier

Hubei

 Recombinant Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Losing Fat Manufactures

Brand Name:YIJING

Model Number:HGH

Place of Origin:SHANGHAI

Recombinant Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Losing Fat Quick Details: IGF LR3 -1 Assay:97% Model:10iu/vial Package:10vial/kit Apperance:White Lyophilized ...

ShangHai ShuCan industrial co.. LTD
Active Member

Shanghai

 IGF LR3 -1 steroid raw powder Manufactures

Categories:Makeup Set

Telephone:00852-21375431

Country/Region:china

IGF LR3 -1 CAS No: Molecular formula: Molecular weight: Appearance:Vial in kit Assay:99% Delivery time:9 days Minimum order:1 kit Supply ability:enough Quality standard:100mcg / ...

SunPower BioPharm Co.,Ltd
ICP Remarked Supplier

 Recombinant HGH Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Fat Loss Manufactures

Place of Origin:jiangsu

Brand Name:hugerawsales06@hotmail.com

Model Number:skype: live:hugerawsales06

Quick Details: IGF LR3 -1 Assay:99.7% Model:10iu/vial Package:10vial/kit Apperance:White Lyophilized powder. Manufacturer :Hezhong Usage : Losing Cellulite and Wrinkles,Gaining ...

Hugeraw Health Technology Co.,Ltd
Active Member

Jiangsu

 Generic Injectable IGF-1 LR3 Bodybuilding Supplement Somatomedins Manufactures

Brand Name:IGF-1 LR3

Place of Origin:China

Generic Injectable IGF-1 LR3 Bodybuilding Supplement Best Muscle Gainer The way IGF-1 LR3 works: The supplementation of mammalian cell cultures with Long R3 IGF-1 at a much lower ...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

 IGF-LR3 Insulin-like Growth Factors Human Growth Hormone Supplements Injections for Wrinkle Remove Manufactures

Brand Name:IGF-LR3

Model Number:0.1mg/vial, 10vials/kit

Place of Origin:China

High Purity IGF-1 HGH Human Growth Hormone Injection Description: IGF-LR3, it has anabolic effects, may increase muscular physique, but also for people in childhood and adolescence...

Guangzhou GenRay Biological Technology Co., Ltd
Active Member

Guangdong

 IGF LR3 -1(Human Growth Hormone) Gaining Muscle Or Weight Loss 10iu/vial!!! Manufactures

Brand Name:Yi Jing

Model Number:mxy0305@ycphar.com

Place of Origin:China mxy0305

IGF LR3 -1(Human Growth Hormone) Gaining Muscle Or Weight Loss 10iu/vial!!!​ Recombinant Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Losing Fat Quick Details: IGF LR3 -1 ...

Shanghai Yi Jing Industrial Co.,Ltd.
Active Member

Shanghai

 IGF-1 LR3 100mcg Increase Muscle Growth Hormone for Injection IGF HGH wholesale Manufactures

Place of Origin:Shen Zhen of China

Brand Name:Igtropin

Model Number:HGH-15

IGF-1 LR3 HGH wholesale,Professional supply Top Quality HGH with lowest Price online and Safe Delivery. IGF-1 LR3 Introduction IGF-1 LR3 is a polypeptide hormone about the same ...

Hongkong HW Biotech Co.,Ltd.
Site Member

Hongkong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request