Sign In | Join Free | My components-electronic.com
components-electronic.com
Products
Search by Category
Home > Agriculture > Eggs >

Hfc Full Form

hfc full form

All hfc full form wholesalers & hfc full form manufacturers come from members. We doesn't provide hfc full form products or service, please contact them directly and verify their companies info carefully.

Total 570 products from hfc full form Manufactures & Suppliers
Buy cheap PⅢ 500 JCAM Trunk Cable Seamless Aluminum Tube for HFC Duplex Transmission Network product

Place of Origin:China

Brand Name:KINGTONE OR OEM

Model Number:Signal Coaxial Cable PⅢ 500 JCAM

...PⅢ 500 JCAM Trunk Cable Seamless AL Tube for HFC Duplex Transmission Network Quick Detail: Signal Coaxial Cable PⅢ 500 JCAM Trunk Cable 0.109 Inches /2....

KINGTONE ELECTRONICS CO.,LTD
Verified Supplier

Zhejiang

Buy cheap High Purity HFC 32 Refrigerant Difluoromethane Replacement Of CH4 product

Brand Name:newradar

Model Number:N/A

Place of Origin:China

... Refrigerant Difluoromethane Replacement Of CH4 Description: Refrigerant Gas Difluoromethane, also called HFC-32 or R-32, is an organic compound of the dihalogenoalkane variety. It is based on ...

Wuhan Newradar Special Gas Co.,Ltd
Verified Supplier

Hubei

Buy cheap ACVR2B 1mg Polypeptide Hormone Myostatin Inhibitor ACE 031 For Building Musclea product

Brand Name:HKYC

Model Number:ACE-031

Place of Origin:China

... acid residues of the ActRIIb-hFc recombinant protein. MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYNANWELERTN QSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQEC VATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Buy cheap PⅢ 500 JCAM Trunk Cable Seamless Aluminum Tube for HFC Duplex Transmission Network product

Brand Name:KINGTONE OR OEM

Model Number:Signal Coaxial Cable PⅢ 500 JCAM

Place of Origin:China

...PⅢ 500 JCAM Trunk Cable Seamless AL Tube for HFC Duplex Transmission Network Quick Detail: Signal Coaxial Cable PⅢ 500 JCAM Trunk Cable 0.109 Inches /2....

KINGTONE ELETRONICS CO.,LTD
Site Member

Shanxi

Buy cheap Nano Carbide Powder SiC VC Cr3C2 WC B4C ZrC NbC Mo2C TiC TaC HfC Etc product

Brand Name:Lambut

Model Number:10-100nm

Place of Origin:China

...Quick Detail: Nano carbide powder SiC, VC, Cr3C2, WC, B4C, ZrC, NbC, Mo2C, TiC, TaC, HfC etc. Grade: Nano silicon carbide powder (SiC) Nano vanadium carbide powder (VC) Nano Chromium carbide...

LAMBUT HEAVY STEEL FORGING
Active Member

Jiangsu

Buy cheap Foam blowing agents HFC-245fa product

Place of Origin:Zhejiang

Brand Name:No brand

Model Number:HFC-245fa

... is an environment friendly fire extinguishing agents as replacements of Halon 1301. - R245fa is an HFC based single components. It is no-ODP. It is the third generation blowing agents replace...

Zhejiang jiahui Industrial Co., Ltd.
Active Member

Zhejiang

Buy cheap HFC Refrigerant GAS Environmental protection R404A Refrigerants product

Brand Name:GALAXY

Model Number:800KG 400KG;50LG 30LB 1000G 500G 350KG

Place of Origin:CHINA

...a (Suva HP62) environmental protection refrigerants Composition: HFC - 125 (44%), HFC - 134 - a (4%) and HFC - 143 - a (52%), type of HFC refrigerants, ODP value is zero, is the industry standard HFC refrigerant replacement R - 502. R - 404 - a is suitable...

HUIZHAN ENERGY MACHINERY CO., LTD
Active Member

Guangdong

Buy cheap Colorless liquid 1,1,1,2,2,3-HEXAFLUOROPROPANE / HFC-236fa Cas 690-39-1 product

Brand Name:Zhonglan

Model Number:ZL

Place of Origin:China

.... Specification of Industrial Raw Materials 99.9% Colorless liquid HFC236fa used as Refrigerant English name: 1,1,1,2,2,3-HEXAFLUOROPROPANE;HFC-236fa CAS : 690-39-1 Content : 99.9% Item Specifications Results Appearance Colorless liquid Conform Content...

Zhonglan Industry Co., Ltd.
Active Member

Buy cheap Carbides HfC product

Categories:Silicon Carbide Mechanical Seal

Telephone:0574-62681100

Country/Region:china

...HfC HfC Technical Parameters Model APS Purity(%) Specific surface (m2/g) Volume density (g/cm3) Density(g/cm3) Crystal form Color NO-C-011-1 800nm 99.9 15.9 3.41 12.7 hexagon black NO-C-011-2 3um 99.9 7.8 3.9 12...

Ningbo JinLei Nano Materials Technology Co., Ltd
ICP Remarked Supplier

Buy cheap Mixed Refrigerant Gas HFC-407 product

Place of Origin:China

Brand Name:cosutin

Model Number:R-407

... No. Typical Wt. % 1, 1, 1, 2-Tetrafluoroethane 811-97-2 52% Pentafluoroethane 354-33-6 25% Difluoromethane 75-10-5 23% Form Compressed liquefied gas Colour Colourless Odour Ether-like PH Neutral PKa Not applicable Melting point...

cosutin Industrial Co., Limited
Active Member

Guangdong

Buy cheap Hafnium Carbide HfC P product

Categories:Powder Metallurgy Parts

Telephone:86-0379-65112007

Country/Region:china

..., superfine hafnium carbide with many compounds (such as ZrC, TaC) form a solid solution. Properties: Appearance: Black Odorless Powder Molecular Formula: HfC Molar mass: 190.50 g/mol Molecular Weight: 103.2347 Melting Point...

Luoyang Tongrun Info Technology Co., Ltd
ICP Remarked Supplier

Buy cheap Hafnium Carbide HfC Powder product

Categories:Powder Metallurgy Parts

Telephone:0086-0379-65112007

Country/Region:china

..., superfine hafnium carbide with many compounds (such as ZrC, TaC) form a solid solution. Properties: Appearance: Black Odorless Powder Molecular Formula: HfC Molar mass: 190.50 g/mol Molecular Weight: 103.2347 Melting Point...

uoyang Tongrun Info Technology Co., Ltd.
ICP Remarked Supplier

Buy cheap Trifluoroethane HFC-143a product

Categories:HFC Refrigerants

Telephone:+86 592 5365887

Country/Region:china

..., if not get any response on time please contact us by Tel or Email.This form is unable to receive your inquiry from aol, hotmail, gmail or others but company email...

Green Stone Swiss company
ICP Remarked Supplier

Buy cheap Trifiluoromethane(HFC-23) product

Categories:HFC Refrigerant

Telephone:+86-571-88748168 88748568

Country/Region:china

...Trifiluoromethane(HFC-23) Products Property of chloride: Chemical Formula CHF3 Boiling Point -82.1? Critical pressure 4.80Mpa@25? Critical density: 2.4(air=1)@25? Volatile: 100% Solubility in water: 0.1%wt%@25? Form: Compressed gas or...

Hitek Industry Co., Ltd
ICP Remarked Supplier

Buy cheap HFC-227EA Automatic Fire Suppression System product

Categories:Fire Hose Reel And Cabinet

Telephone:+86-21-68062016

Country/Region:china

...HFC-227EA Automatic Fire Suppression System Inquiry Form The HFC-227EA automatic fire suppression system is an excellent extinguishing system because it is fast acting ...

firefightingtool company
ICP Remarked Supplier

Buy cheap Trifiluoromethane(HFC-23) product

Categories:HFC Refrigerants

Telephone:86+571+88746383, 88746477, 88746499

Country/Region:china

...            100% Solubility in water:            0.1%wt%@25℃ Form:                                Compressed gas or liquefied gas Density:                           1.44g...

Hangzhou Sporlan Heating & Refrigerating Equipment CO.LTD.
ICP Remarked Supplier

Zhejiang

Buy cheap Thermal Engineering HFC 134A Charge Check Refrigerant Charging Cylinder U7001 product

Categories:HFC Refrigerant

Country/Region:china

... be removed from the case as all connections and valves are accessible from front. Case forms a stand to set on the floor or bench. Are easily used in the field. They...

TruTech Tools, LTD
ICP Remarked Supplier

Buy cheap HFCs 25R410A product

Categories:HFC Refrigerants

Telephone:893457983

Country/Region:china

... TERMINOLOGY FAQs UNITED STATES CANADA HFCs R-23 R-134a R-404A R-407A R-407C R-410A R-422B R-422C R-422D R-507 R-508B HCFCs CFCs A blend of R-32 and R-125 that nearly forms an azeotrope, which means it...

refrigerants company
ICP Remarked Supplier

Buy cheap High Fructose Corn Syrup Production Line (HFCS Processing Plant) product

Categories:Sugar Production Line

Telephone:0086-371-55397895

Country/Region:china

... isomerization and form fructose so as to improve fructose content in the mixing syrup. High Fructose Corn Syrup Production Line (HFCS Processing Plant) technological process: High Fructose Corn Syrup Production Line (HFCS Processing...

Henan Institute Of Grain Machinery Manufacturing Co., Ltd
ICP Remarked Supplier

Buy cheap HFC Refrigerant R408A Refrigerant Gas Wth Cylinder Packing Refrigerant product

Categories:R22 Refrigerant Gas

Telephone:86-570-8704498

Country/Region:china

... HFC-32 HFC-125 Chemical name Difluoromethane Pentafluoroethane Molecular formula CH2F2 CHF2CF3 Weight% 50% 50% Molecular weight 72.6 Boiling point -52.7 °C Critical temperature 72.5°C Critical pressure 4950kPa Odor Slight ethereal Form Liquefied...

QuZhou Bingcool Refrigerant Manufacture Co.,LTD
ICP Remarked Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request